S10A8_RAT   P50115


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50115

Recommended name:Protein S100-A8

EC number:

Alternative names:

Cleaved into:

GeneID:116547

Gene names  (primary ):S100a8

Gene names  (synonym ):Mrp8

Gene names  (ORF ):

Length:89

Mass:10,239

Sequence:MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp