CXL10_RAT P48973
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48973
Recommended name：C-X-C motif chemokine 10
EC number：
Alternative names：
Cleaved into：
GeneID：245920
Gene names (primary )：Cxcl10
Gene names (synonym )：Inp10, Mob1, Scyb10
Gene names (ORF )：
Length：98
Mass：10,729
Sequence：MNPSAAVVLCLVLLSLSGTQGIPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
Tissue specificity：In the central nervous system, CXCL10 is predominantly localized to activated neurons (PubMed:30448292). Expressed in both microglia and astrocytes (PubMed:30257241). 2 s
Induction：
Developmental stage：
Protein families：