CAH4_RAT P48284
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48284
Recommended name：Carbonic anhydrase 4
EC number：EC:4.2.1.1
Alternative names：Carbonate dehydratase IV Carbonic anhydrase IV (CA-IV)
Cleaved into：
GeneID：29242
Gene names (primary )：Ca4
Gene names (synonym )：
Gene names (ORF )：
Length：309
Mass：35,076
Sequence：MQLLLALLALAYVAPSTEDSHWCYEIQAKEPNSHCSGPEQWTGDCKKNQQSPINIVTSKTKLNPSLTPFTFVGYDQKKKWEVKNNQHSVEMSLGEDIYIFGGDLPTQYKAIQLHLHWSEESNKGSEHSIDGKHFAMEMHVVHKKMTTGDKVQDSDSKDKIAVLAFMVEVGNEVNEGFQPLVEALSRLSKPFTNSTVSESCLQDMLPEKKKLSAYFRYQGSLTTPGCDETVIWTVFEEPIKIHKDQFLEFSKKLYYDQEQKLNMKDNVRPLQPLGNRQVFRSHASGRLLSLPLPTLLVPTLTCLVASFLH
Tissue specificity：Present in kidney and lung. Also particularly abundant in brain, muscle, heart and liver. Not detected in skin or spleen. 1
Induction：
Developmental stage：
Protein families：