AQP3_RAT P47862
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47862
Recommended name：Aquaporin-3 1 Publication
EC number：
Alternative names：31.4 kDa water channel protein Aquaglyceroporin-3
Cleaved into：
GeneID：65133
Gene names (primary )：Aqp3
Gene names (synonym )：
Gene names (ORF )：
Length：292
Mass：31,384
Sequence：MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWAFAGNELVVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGQNWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPPPSTEAENVKLAHMKHKEQI
Tissue specificity：Detected in kidney medulla and papilla, in collecting duct cells (PubMed:7517548, PubMed:7526388). Detected in colon (PubMed:7517548). 2 s
Induction：
Developmental stage：
Protein families：MIP/aquaporin (TC 1.A.8) family