PO2F3_RAT P42571
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P42571
Recommended name：POU domain, class 2, transcription factor 3
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Pou2f3
Gene names (synonym )：Otf11, Skn-1, Skn1
Gene names (ORF )：
Length：430
Mass：46,805
Sequence：MVNLEPMHTEIKMSGDVADSTDARSTFGQVESGNDRNGLDFNRQIKTEDLGDTLQQSLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLTSQAVGRPGLSGSSLEPHLEASQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGSLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNPSSAAFNSSGSWYRWNHPAYLH
Tissue specificity：Expressed in epidermis and hair follicles. 1
Induction：
Developmental stage：
Protein families：