TNFL6_RAT P36940
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36940
Recommended name：Tumor necrosis factor ligand superfamily member 6
EC number：
Alternative names：Tumor necrosis factor ligand superfamily member 6, membrane formTumor necrosis factor ligand superfamily member 6, soluble form Alternative names: Receptor-binding FasL ectodomain, Soluble Fas ligand (sFasL) ADAM10-processed FasL form (APL) FasL intracellular domain (FasL ICD) Alternative names: SPPL2A-processed FasL form (SPA)
Cleaved into：
GeneID：25385
Gene names (primary )：Faslg
Gene names (synonym )：Apt1Lg1, Cd95l, Fasl, Tnfsf6
Gene names (ORF )：
Length：278
Mass：31,140
Sequence：MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQPPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
Tissue specificity：Expressed in activated splenocytes and thymocytes. Moderate or weak expression found in small intestines, kidney and lung. 1
Induction：
Developmental stage：By PMA/ionomycin and concanavalin/interleukin-2. 1
Protein families：