KLK10_RAT P36375
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36375
Recommended name：Glandular kallikrein-10
EC number：EC:3.4.21.35
Alternative names：K10; rGK-10
Cleaved into：
GeneID：292858
Gene names (primary )：Klk10
Gene names (synonym )：Klk-10
Gene names (ORF )：
Length：259
Mass：28,981
Sequence：MWFLILFLALSLGGIDAAPPGQSRIVGGYKCEKNSQPWQVAIINEYLCGGVLIDPSWVITAAHCYSNYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSNDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLNWELPDDLQCVNIHLLSNEKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIKEVMKENP
Tissue specificity：Kidney and submandibular gland, where it is found in the granular convoluted tubule and striated duct cells. It is likely that the enzyme is mainly synthesized in the granular convoluted tubules and then transferred to other tissues by release into the vasculature or interstitial space. 1
Induction：
Developmental stage：
Protein families：