NTF4_RAT P34131
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34131
Recommended name：Neurotrophin-4
EC number：
Alternative names：Neurotrophin-5 (NT-5) Neutrophic factor 4
Cleaved into：
GeneID：25730
Gene names (primary )：Ntf4
Gene names (synonym )：Nt4, Ntf5
Gene names (ORF )：
Length：209
Mass：22,333
Sequence：MLPRHSCSLLLFLLLLPSVPMEPQPPSSTLPPFLAPEWDLLSPRVALSRGTPAGPPLLFLLEAGAYGEPAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
Tissue specificity：Expressed in thymus, muscle, ovary, brain, heart, stomach and kidney. Expressed in both embryo and adult tissues. 1
Induction：
Developmental stage：
Protein families：