CXCL2_RAT P30348
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30348
Recommended name：C-X-C motif chemokine 2
EC number：
Alternative names：
Cleaved into：
GeneID：114105
Gene names (primary )：Cxcl2
Gene names (synonym )：Cinc3, Mip-2, Mip2, Scyb2
Gene names (ORF )：
Length：100
Mass：10,783
Sequence：MAPPTRQLLNAVLVLLLLLATNHQGTGVVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Tissue specificity：At least expressed in the lung and trachea.
Induction：
Developmental stage：By lipopolysaccharide (LPS) and inflammation; in lung.
Protein families：