PSB5_RAT P28075
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28075
Recommended name：Proteasome subunit beta type-5
EC number：EC:3.4.25.1
Alternative names：Macropain epsilon chain Multicatalytic endopeptidase complex epsilon chain Proteasome chain 6 Proteasome epsilon chain Proteasome subunit X Proteasome subunit beta-5 (beta-5)
Cleaved into：
GeneID：29425
Gene names (primary )：Psmb5
Gene names (synonym )：
Gene names (ORF )：
Length：263
Mass：28,585
Sequence：MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYTSSIP
Tissue specificity：Down-regulated by theophylline (THP) and up-regulated by 1,3-dinitrobenzene (DNB), two reprotoxic agents thought to induce infertility. 1
Induction：
Developmental stage：
Protein families：