CATD_RAT   P24268


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P24268

Recommended name:Cathepsin D

EC number:EC:3.4.23.5

Alternative names:Cathepsin D 12 kDa light chain Cathepsin D 9 kDa light chain Cathepsin D 34 kDa heavy chain Cathepsin D 30 kDa heavy chain

Cleaved into:

GeneID:

Gene names  (primary ):Ctsd

Gene names  (synonym ):

Gene names  (ORF ):

Length:407

Mass:44,681

Sequence:MQTPGVLLLILGLLDASSSALIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPRTKEPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQPGVVFIAAKFDGILGMGYPFISVNKVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGELMLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTICLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp