GRP_RAT P24393
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24393
Recommended name：Gastrin-releasing peptide
EC number：
Alternative names：Neuromedin-C Alternative names: GRP-10, GRP18-27 By Similarity
Cleaved into：
GeneID：171101
Gene names (primary )：Grp
Gene names (synonym )：
Gene names (ORF )：
Length：147
Mass：15,702
Sequence：MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDELPPLYAADRDGLKEQLRGYIRWEEAARNLLGLLEAAGNRSHQPPQDQPLGSLQPTWDPEDGSYFSDAQNAKLVDSLLQVLKGKEGTAS
Tissue specificity：Expressed in several dozen cells in the dorsal retrotrapezoid nucleus/parafacial respiratory group (at protein level). 1
Induction：
Developmental stage：
Protein families：