REG3B_RAT P25031
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25031
Recommended name：Regenerating islet-derived protein 3-beta Curated
EC number：
Alternative names：Pancreatitis-associated protein 1 Peptide 23 REG-2 Regenerating islet-derived protein III-beta (Reg III-beta)
Cleaved into：
GeneID：24618
Gene names (primary )：Reg3b
Gene names (synonym )：Pap, Pap1, Reg2
Gene names (ORF )：
Length：175
Mass：19,617
Sequence：MLHRLAFPVMSWMLLSCLMLLSQVQGEDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Tissue specificity：Constitutively expressed in intestine. 1
Induction：
Developmental stage：Appears in pancreatic juice after induction of pancreatic inflammation. Secreted also by pituitary cells; the secretion there is stimulated by GH-releasing hormone and inhibited by somatostatin. 3 s
Protein families：