ODFP1_RAT P21769
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21769
Recommended name：Outer dense fiber protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：24610
Gene names (primary )：Odf1
Gene names (synonym )：Odf27, Odfp, Rt7
Gene names (ORF )：
Length：245
Mass：27,351
Sequence：MAALSCLLDSVRRDIKKVDRELRQLRCIDEISSRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYYPCCLCDYKLYCLRPSLRSLERLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCNPCNPCSPCSPCGPCGPCGPCGPCGPCGPCDPCNPCYPCGSRFSCRKMIL
Tissue specificity：Testis. Specifically located to the round spermatid layer and to the luminally-oriented cytoplasm of elongated spermatids.
Induction：
Developmental stage：First detected in 30-day old rats after which, levels increase during spermatid elongation. Levels decrease at the time of spermatid assembly and disappear just before spermiation.
Protein families：