CP2A3_RAT P20812
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20812
Recommended name：Cytochrome P450 2A3
EC number：EC:1.14.14.1
Alternative names：CYPIIA3 Coumarin 7-hydroxylase
Cleaved into：
GeneID：24299
Gene names (primary )：Cyp2a3
Gene names (synonym )：Cyp2a-3, Cyp2a3a
Gene names (ORF )：
Length：494
Mass：56,510
Sequence：MLASGLLLVASVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNYLQLNTEKMYSSLMKISQRYGPVFTIHLGPRRVVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIESFRKTNGALIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQAKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFREFLLPKGTEVFPMLGSVLKDPKFFSNPNDFNPKHFLDDKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFCFKSPQAPQDIDVSPRLVGFATIPPNYTMSFLSR
Tissue specificity：Lung.
Induction：
Developmental stage：By 3-methylcholanthrene (3MC).
Protein families：