IAPP_RAT P12969
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12969
Recommended name：Islet amyloid polypeptide 1 Publication
EC number：
Alternative names：Amylin 1 Publication Diabetes-associated peptide By Similarity (DAP)
Cleaved into：
GeneID：24476
Gene names (primary )：Iapp
Gene names (synonym )：
Gene names (ORF )：
Length：93
Mass：10,015
Sequence：MRCISRLPAVLLILSVALGHLRATPVGSGTNPQVDKRKCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYGKRNVAEDPNRESLDFLLL
Tissue specificity：Abundant in the islets of Langerhans but is not present in the brain or seven other tissues examined.
Induction：
Developmental stage：
Protein families：calcitonin family