UDB17_RAT P08542
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08542
Recommended name：UDP-glucuronosyltransferase 2B17 Curated
EC number：EC:2.4.1.17
Alternative names：UDPGT 2B17; UGT2B17
Cleaved into：
GeneID：266685
Gene names (primary )：Ugt2b17
Gene names (synonym )：Ugt2b3, Ugt2b5
Gene names (ORF )：
Length：530
Mass：60,525
Sequence：MPGKWISALLLLQISCCFQSGNCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSAYYVLDPKKSPDLKFETFPTSVSKDELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGFSDYYLSLCKDTVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYKIEKSSGRFILPPSYVPVILSGMGGPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEILGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSSGEHGVVVFSLGSMVSSMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHSGANGVYEAIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRTMSKSDLFNALKEIINNPFYKKNAVWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPLGHDLPWYQYHSLDVIGFLLTCSAVIAVLTVKCFLFIYRLFVKKEKKMKNE
Tissue specificity：Constitutively expressed.
Induction：
Developmental stage：
Protein families：