UDB17_RAT   P08542


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P08542

Recommended name:UDP-glucuronosyltransferase 2B17 Curated

EC number:EC:2.4.1.17

Alternative names:UDPGT 2B17; UGT2B17

Cleaved into:

GeneID:266685

Gene names  (primary ):Ugt2b17

Gene names  (synonym ):Ugt2b3, Ugt2b5

Gene names  (ORF ):

Length:530

Mass:60,525

Sequence:MPGKWISALLLLQISCCFQSGNCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSAYYVLDPKKSPDLKFETFPTSVSKDELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGFSDYYLSLCKDTVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYKIEKSSGRFILPPSYVPVILSGMGGPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEILGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSSGEHGVVVFSLGSMVSSMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHSGANGVYEAIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRTMSKSDLFNALKEIINNPFYKKNAVWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPLGHDLPWYQYHSLDVIGFLLTCSAVIAVLTVKCFLFIYRLFVKKEKKMKNE

Tissue specificity:Constitutively expressed.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp