S10AA_RAT P05943
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P05943
Recommended name：Protein S100-A10
EC number：
Alternative names：
Cleaved into：
GeneID：81778
Gene names (primary )：S100a10
Gene names (synonym )：
Gene names (ORF )：
Length：95
Mass：11,075
Sequence：MPSQMEHAMETMMLTFHRFAGEKNYLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKK
Tissue specificity：By nerve growth factor.
Induction：
Developmental stage：
Protein families：