DNPH1_RAT O35820
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35820
Recommended name：5-hydroxymethyl-dUMP N-hydrolase By Similarity
EC number：EC:3.2.2.-
Alternative names：2'-deoxynucleoside 5'-phosphate N-hydrolase 1 Imported Deoxyribonucleoside 5'-monophosphate N-glycosidase 1 Publication c-Myc-responsive protein Rcl 1 Publication
Cleaved into：
GeneID：171047
Gene names (primary )：Dnph1
Gene names (synonym )：Rcl 1 Publication
Gene names (ORF )：
Length：163
Mass：17,781
Sequence：MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
Tissue specificity：Highly expressed in heart, kidney, liver and spleen. Weakly expressed in lung and skeletal muscle. 1
Induction：
Developmental stage：Up-regulated in response to c-Myc and by partial hepatectomy. 1
Protein families：