PTPRR_RAT O08617
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08617
Recommended name:Receptor-type tyrosine-protein phosphatase R
EC number:EC:3.1.3.48
Alternative names:R-PTP-R
Cleaved into:
GeneID:
Gene names (primary ):Ptprr
Gene names (synonym ):Ptp
Gene names (ORF ):
Length:656
Mass:73,907
Sequence:MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPMFIYDHSQDIKKSLDIAQEAYKHNYPAPSEVQISKRHQIVDSAFPRPAYDPSLNLLAASGQDLEIENLPIPAANVIVVTLQMDIDKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKSQIELFVSPGNRKPGEPQALQAEEVLRSLNVDVLRQSLPQFGSIDVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIIIVTCLMIIYRLKERLQLSFRQDKEKNQEIHLSPIALQQAQSEAKAAHSMVQPDQAPKVLNVVVDPQGQCTPEIRNTASTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAVSTPREKVAMEYLQSASRVLTSPQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDPLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVIGVNECDNYTIRNLVLKRGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVQ
Tissue specificity:Widely expressed in the brain, most abundant in cerebellum, midbrain, cerebral cortex and hippocampus. Also expressed in heart and skeletal muscle. 2 s
Induction:
Developmental stage:By nerve growth factor; isoform 2 is induced in adrenal tumor cells 2 hours after exposure, levels are down-regulated 24 hours after treatment. 1
Protein families: