DHRS6_RAT D4A1J4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4A1J4
Recommended name：Dehydrogenase/reductase SDR family member 6
EC number：EC:1.1.1.-
Alternative names：(R)-beta-hydroxybutyrate dehydrogenase 3-hydroxybutyrate dehydrogenase type 2 (EC:1.1.1.30 By Similarity) . EC:1.1.1.30 (UniProtKB | ENZYME | Rhea) By Similarity 4-oxo-L-proline reductase (EC:1.1.1.104 1 Publication) . EC:1.1.1.104 (UniProtKB | ENZYME | Rhea) 1 Publication Oxidoreductase UCPA Short chain dehydrogenase/reductase family 15C member 1
Cleaved into：
GeneID：295458
Gene names (primary )：Bdh2
Gene names (synonym )：Dhrs6
Gene names (ORF )：
Length：245
Mass：26,651
Sequence：MGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENYPGIQTRVLDVTKKRQIDQFASEIEKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDDPKEALKAFLNRQKTGRFASAEEVALLCVYLASDESAYVTGTPVVIDGGWSL
Tissue specificity：
Induction：
Developmental stage：
Protein families：