UB2D1_RAT D3ZDK2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3ZDK2
Recommended name：Ubiquitin-conjugating enzyme E2 D1
EC number：EC:2.3.2.23
Alternative names：(E3-independent) E2 ubiquitin-conjugating enzyme D1 (EC:2.3.2.24) . EC:2.3.2.24 (UniProtKB | ENZYME | Rhea) E2 ubiquitin-conjugating enzyme D1 Ubiquitin carrier protein D1 Ubiquitin-conjugating enzyme E2(17)KB 1 Ubiquitin-conjugating enzyme E2-17 kDa 1 Ubiquitin-protein ligase D1
Cleaved into：
GeneID：361831
Gene names (primary )：Ube2d1
Gene names (synonym )：
Gene names (ORF )：
Length：147
Mass：16,602
Sequence：MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
Tissue specificity：
Induction：
Developmental stage：
Protein families：