STK24_RAT   B0LT89


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B0LT89

Recommended name:Serine/threonine-protein kinase 24

EC number:EC:2.7.11.1

Alternative names:Mammalian STE20-like protein kinase 3 (MST-3; MST3b) STE20-like kinase MST3

Cleaved into:

GeneID:361092

Gene names  (primary ):Stk24

Gene names  (synonym ):Mst3 By Similarity, Stk3 By Similarity

Gene names  (ORF ):

Length:431

Mass:47,990

Sequence:MAHSPVQSGLPGMQTLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGSYSRPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKKTSYLTELIDRYKRWKAEQSHEDSSSEDSDVETDSQASGGSDSGDWIFTIREKDPKNLENGTLQPSDLERNKMKDFPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGASAH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp