OSR1_RAT   B0K011


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B0K011

Recommended name:Protein odd-skipped-related 1

EC number:

Alternative names:

Cleaved into:

GeneID:298878

Gene names  (primary ):Osr1

Gene names  (synonym ):Odd1

Gene names  (ORF ):

Length:266

Mass:29,584

Sequence:MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFANLALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp