MCL1_RAT   Q9Z1P3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z1P3

Recommended name:Induced myeloid leukemia cell differentiation protein Mcl-1 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:60430

Gene names  (primary ):Mcl1

Gene names  (synonym ):

Gene names  (ORF ):

Length:330

Mass:35,214

Sequence:MFGLRRNAVIGLNLYCGGASLGAGGGSPAGTRLAAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPPEEMAASAAAIMSPEEELDGCEPEVLSKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEDDELYRQSLEIISRYLREQATGSKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSFSRVMTHVFKDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR

Tissue specificity:Ubiquitous. Highly expressed in heart, spleen, lung, liver, skeletal muscle and kidney. Detected at lower levels in brain, ovary, oviduct and testis. 1

Induction:

Developmental stage:Detected in neonate ovaries and expressed at constant levels in 3 to 6 day old animals. Levels are increased in at day 12 and thereafter.

Protein families:


   💬 WhatsApp