LAT2_RAT Q9WVR6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WVR6
Recommended name：Large neutral amino acids transporter small subunit 2
EC number：
Alternative names：
Cleaved into：
GeneID：84551
Gene names (primary )：Slc7a8
Gene names (synonym )：Lat2, Lat4
Gene names (ORF )：
Length：533
Mass：58,190
Sequence：MEKGTRQRNNTAKNHPDRGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGVVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKISLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIESLTLVSQKMCVVVYPQEGDSGTEETIDDVEEQHKPIFQPTPVKDPDSEEQP
Tissue specificity：Expression is seen in jejunum mucosa and the epithelial cells of the jejunum, ileum and colon, as well as in kidney, placenta, brain, testis and skeletal muscle. Expressed in retina, inner blood-retinal barrier of retina, retinal vascular endothelial cells. Also expressed in the intestinal epithelial cell line IEC-6 and in the retinal capillary endothelial cell line TR-iBRB2. 3 s
Induction：
Developmental stage：
Protein families：