KAD4_RAT Q9WUS0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUS0
Recommended name：Adenylate kinase 4, mitochondrial By Similarity
EC number：EC:2.7.4.4
Alternative names：Adenylate kinase 3-like UniRule Annotation GTP:AMP phosphotransferase AK4 UniRule Annotation
Cleaved into：
GeneID：29223
Gene names (primary )：Ak4
Gene names (synonym )：
Gene names (ORF )：
Length：223
Mass：25,203
Sequence：MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTNTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDRICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVLGVDDITGEPLVQQEDDKPEALAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY
Tissue specificity：Expressed in the pyramidal cells in the hippocampus. 1
Induction：
Developmental stage：Expressed in the central nervous system in a region-specific manner from the middle stage of embryogenesis to the adulthood in the rodent. 1
Protein families：adenylate kinase family