MK_RAT Q9R1S9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1S9
Recommended name:Midkine 2 Publications
EC number:
Alternative names:
Cleaved into:
GeneID:81517
Gene names (primary ):Mdk
Gene names (synonym ):
Gene names (ORF ):
Length:140
Mass:15,406
Sequence:MQHRSFFLLALVALLAVTTAVAKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD
Tissue specificity:Expressed at a low level in arteries, and at higher levels in newly formed neointima. In brain, expressed in the caudate nucleus and the brain stem. 2 s
Induction:In the cortices of the adrenal glands, expressed at 12.5 dpc, decreases considerably at 15.5 dpc and is almost undetectable in the newborn stage. In brain, expressed at low levels in early embryos, expression peaks between 12 dpc and 14 dpc, and rapidly falls until birth when expression is barely detectable. 2 Publications
Developmental stage:In arteries 3 days after injury. Expression continues to increase until day 7 after injury and decreases slightly by day 14. 1
Protein families: