S22A4_RAT Q9R141
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R141
Recommended name：Solute carrier family 22 member 4 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：64037
Gene names (primary )：Slc22a4
Gene names (synonym )：Octn1
Gene names (ORF )：
Length：553
Mass：62,362
Sequence：MRDYDEVIAFLGDWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCLVPHTVNLSSAWRNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGLDVDLEQLEQESCLDGWEYSKDVFLSTIVTEWNLVCEDDWKTPLTTSLFFVGVLCGSFVSGQLSDRFGRKKVLFATMAVQTGFSFVQIFSTNWEMFTVLFAIVGMGQISNYVVAFILGTEILSKSVRILFSTLGVCTFFAIGYMVLPLFAYFIRDWRMLLLALTLPGLFCVPLWWFIPESPRWLISQRRFEEAEQIIQKAAKMNGIMAPAVIFDPLELQELNSLKQQKVFILDLFKTRNIATITVMSVMLWMLTSVGYFALSLNVPNLHGDVYLNCFLSGLIEVPAYFTAWLLLRTLPRRYIIAGVLFWGGGVLLLVQVVPEDYNFVSIGLVMLGKFGVTSAFSMLYVFTAELYPTLVRNMAVGITSMASRVGSIIAPYFVYLGAYNRLLPYILMGSLTVLIGIITLFFPESFGVTLPENLEQMQKVRGFRCGKKSTVSMDREENPKVLITAF
Tissue specificity：Expressed in intestine, liver and kidney. Weakly expressed in brain, thymus, lung, spleen, heart and skin. In brain, it is expressed in cerebellum, especially in the granular layer, in hippocampus and cortex. In kidney, it is expressed in cortex and medulla with relatively more abundance in the cortical-medullary junction. In heart, it is expressed in myocardium and valves. Expressed labyrinthine zone of the placenta (PubMed:10825452). Expressed in Sertoli cells in testis (PubMed:17616214). 2 s
Induction：
Developmental stage：
Protein families：