PHOCN_RAT   Q9QYW3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QYW3

Recommended name:MOB-like protein phocein

EC number:

Alternative names:

Cleaved into:

GeneID:171050

Gene names  (primary ):Mob4

Gene names  (synonym ):Mob3, Mobkl1, Phocn, Prei3

Gene names  (ORF ):

Length:225

Mass:26,032

Sequence:MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

Tissue specificity:Highly expressed in adrenal gland, spinal cord, brain and cerebellum. Detected at lower levels in heart and skeletal muscle, and at very low levels in spleen, liver and intestine. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp