LRAT_RAT Q9JI61
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JI61
Recommended name：Lecithin retinol acyltransferase
EC number：EC:2.3.1.135
Alternative names：Phosphatidylcholine--retinol O-acyltransferase
Cleaved into：
GeneID：64047
Gene names (primary )：Lrat
Gene names (synonym )：
Gene names (ORF )：
Length：231
Mass：25,810
Sequence：MKNSMLEAASLLLEKLLLISNFKIFSVCAPGGGTGKKHPYEINSFLRGDVLEVSRTHFTHYGIYLGDNRVAHLMPDILLALTSDKERTQKVVSNKRLLPGVICKVASIRVDTVEDFAYGADILVNHLDETLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSPISPQAEKFHETVKILIRDQRSCLASAVLGLVSIIYTGLASYMTLPAVCIPFCLWMMSG
Tissue specificity：Hepatic stellate cells and endothelial cells (at protein level). Highly expressed in adrenal gland, small intestine, testis and eye. Lower levels of expression are observed in liver, heart, lung, skin, mammary tissue and skeletal muscle. 2 s
Induction：
Developmental stage：LRAT activity is up-regulated by dietary vitamin A. Under conditions of vitamin A depletion, LRAT expression in the liver is induced by retinoic acid. 2 s
Protein families：