ECEL1_RAT Q9JHL3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHL3
Recommended name：Endothelin-converting enzyme-like 1
EC number：EC:3.4.24.-
Alternative names：Damage-induced neuronal endopeptidase Xce protein
Cleaved into：
GeneID：60417
Gene names (primary )：Ecel1
Gene names (synonym )：Dine, Xce
Gene names (ORF )：
Length：775
Mass：87,944
Sequence：MEAPYSMTAHYDEFQEVKYESRCGTGGARGTSLPPGFPRSSGRSASGARSGLPRWNRREVCLLSGLVFAAGLCAILAAMLALKYLGPGAAGTGGACPEGCPERKAFARAARFLSANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQNEERLRRLLARPTGGPGGAAQRKVRAFFRSCLDMREIERLGPRPMLEVIEDCGGWDLGGAADRPGAARWDLNRLLYKAQGVYSAAALFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEGSEKVLAAYKVFMERLLRLLGADAVEQKAQEILQLEQRLANISVSEYDDLRRDVSSVYNKVTLGQLQKITPHLQWKWLLDQIFQEDFSEEEEVVLLATDYMQQVSQLIRSTPRRILHNYLVWRVVVVLSEHLSPPFREALHELAKEMEGNDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLEELDWMDAQTKAAARAKLQYMMVMVGYPDFLLKPEAVDKEYEFEVHEKTYLKNILNSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLHKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYYAYQKWVREHGPEHPLHRLKYTHNQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPMNPVHKCSVW
Tissue specificity：Highly expressed in the CNS, in particular in neurons of the caudate putamen, diagonal band, the paraventricular nucleus of the thalamus, part of the hypothalamus, in cranial motor nuclei, inferior olive, and substantia gelatinosa of the spinal tract trigeminal nucleus. Not detected in cerebral cortex, hippocampus and cerebellum.
Induction：
Developmental stage：By mechanical damage to nerve cells.
Protein families：