ENTP6_RAT   Q9ER31


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ER31

Recommended name:Ectonucleoside triphosphate diphosphohydrolase 6

EC number:EC:3.6.1.6

Alternative names:NTPDase 6

Cleaved into:

GeneID:85260

Gene names  (primary ):Entpd6

Gene names  (synonym ):Cd39l2

Gene names  (ORF ):

Length:455

Mass:49,899

Sequence:MRKIPNHGTLRMTKVAYPLGLCVGLFIYVAYIKWHRASAAQAFFTIAGAASGVRWTQQAFSSPDSATRGHEVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIPYDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGSLKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTFKLYSYSYLGLGLMSARLAILGGVEGKPAEDDKELVSPCLSPRFRGKWEHAEVTYRISGQKAVGLYELCASRVSEVLRNKVHRTEEAQHVDFYAFSYYYDLAASFGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPPSSPFACMDLTYISLLLHEFGFPGDKVLKLARKIDNVETSWALGAIFHYIDSLKRQKVPAL

Tissue specificity:Expressed in heart and brain. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp