CRY2_RAT   Q923I8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q923I8

Recommended name:Cryptochrome-2

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Cry2

Gene names  (synonym ):

Gene names  (ORF ):

Length:594

Mass:67,223

Sequence:MAAAAVVAATVPVQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPVGAVSSQHMENCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALVRLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAANCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLWASVPSCVEDLSHPVAEPGSSQAGSISNTGPRPLSSGPASPKRKLEAAEEPPGEELSKRARVTVTQMPAQEPPSKDS

Tissue specificity:Expressed in all tissues examined including heart, cerebellum, cerebral cortex, lung, liver, muscle, kidney and ovary. Highest levels in heart, liver and ovary. Highly expressed in the suprachiasmatic nucleus (SCN). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp