PLPP2_RAT   Q8K593


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K593

Recommended name:Phospholipid phosphatase 2 Curated

EC number:EC:3.1.3.-

Alternative names:Lipid phosphate phosphohydrolase 2 PAP2-gamma (PAP2-G) Phosphatidate phosphohydrolase type 2c Phosphatidic acid phosphatase 2c (PAP-2c; PAP2c)

Cleaved into:

GeneID:246115

Gene names  (primary ):Plpp2

Gene names  (synonym ):Lpp2, Ppap2c

Gene names  (ORF ):

Length:276

Mass:31,101

Sequence:MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVIITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLALYVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVCYVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP

Tissue specificity:Expressed in the brain. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp