AMGO1_RAT Q80ZD7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZD7
Recommended name：Amphoterin-induced protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：295365
Gene names (primary )：Amigo1 By Similarity
Gene names (synonym )：Ali2 By Similarity, Amigo 1 Publication
Gene names (ORF )：
Length：493
Mass：55,283
Sequence：MQPQRDLRGLWLLLLSLFLLLFEVARAGRPVVSCPANCLCASNILSCSKQQLPNVPQSLPGYTALLDLSHNNLSRLKAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSGLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNMISRFPLELIKDANRLPKLTLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCVHSKKLHNVFSLDFFNCSEYKESAWEAHLGDTLTITCDTKQQGMTKVWVTPSNEQVLNQGANGTVTVSEDGNLHFKEVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV
Tissue specificity：By HMGB1/amphoterin; in cultured hippocampal neurons. 1
Induction：
Developmental stage：Expressed at moderate levels in the central nervous system of stage 13-14 embryos. Highest levels at this stage in fiber tracts from dorsal root ganglia and trigeminal ganglion to the spinal cord as well as in fibers on both sides of the Purkinje cell layer of the cerebellum. Expression is down-regulated during postnatal stages P6 to P10 followed by up-regulation at the onset of myelination. High level expression in most myelinated axon tracts of the adult including cerebellum, pons, medulla, and spinal cord as well as in nonmyelinated fiber tracts in the striatum lucidum CA3 region of the hippocampus. 1
Protein families：immunoglobulin superfamily