FCG3A_RAT   Q6XPU4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6XPU4

Recommended name:Low affinity immunoglobulin gamma Fc region receptor III-A By Similarity

EC number:

Alternative names:CD16-2 By Similarity FcgammaRIV By Similarity

Cleaved into:

GeneID:304966

Gene names  (primary ):Fcgr3a

Gene names  (synonym ):Fcgr4

Gene names  (ORF ):

Length:249

Mass:28,168

Sequence:MWYLLLPTALLLTVSSGVGAGLQKAVVNLDPEWVRVLEEDCVILRCQGTFSPEDNSTKWFHNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADWLLLQTTKRLFQEGDPIRLRCHSWRNTPVFKVTYLQNGKGKKYFHRNSELSISKATHADSGSYFCRGIIGRNNISSASLQISIGDPTSPSSFLPWHQITFCLLIGLLFAIDTVLYFSVQRSLQSSVAVYEEPKLHWSKEPQDK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp