NHLC1_RAT   Q6IMG5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IMG5

Recommended name:E3 ubiquitin-protein ligase NHLRC1

EC number:EC:2.3.2.27

Alternative names:Malin NHL repeat-containing protein 1 RING-type E3 ubiquitin transferase NHLRC1 Curated

Cleaved into:

GeneID:364682

Gene names  (primary ):Nhlrc1

Gene names  (synonym ):Epm2b

Gene names  (ORF ):

Length:396

Mass:42,089

Sequence:MGEEAAGVRPELVREAEVSLLECKVCFERFGHRQQRRPRNLPCGHVVCLACVAALAHPRTLALECPFCRRACRACDTSDCLPVLHLLELLGSTLHASPAALSAASCAPGALTCYHAFGGWGTLVNPTGLALCPKTGRVVVVHDGKRRVKIFDSGGGGAHQFGEKGDAAHDVKYPLDVAVTNDCHVVVTDAGDCSLKVFDFFGQIKLVVGKQFSLPWGVEITPHNGVLVTDAEAGTLHLLEADFPEGVLRRIERLQAHLCNPRGVAVSWLTGAIAVLEHPCALGTSSGNNTRVKVFNSSMQLIGQVDSFGLNLLFPSKITASAVTFDHQGNVIVADTSGPAIVCLGKPEEFPALKPMVTHGLSRPVALVFTKENSLLVLDSASHSIKVFKVMEGNGG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp