PTF1A_RAT Q64305
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64305
Recommended name：Pancreas transcription factor 1 subunit alpha
EC number：
Alternative names：
Cleaved into：
GeneID：117034
Gene names (primary )：Ptf1a
Gene names (synonym )：Ptf1p48
Gene names (ORF )：
Length：326
Mass：35,305
Sequence：MDAVLLEHFPGALDTFPSSYFDEEDFFTDQSSRDPLEDGDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDSGSYCCDAGAPLGAFPYSPGSPPSCLAYPCTAVLSPGTRLRGLNGAAAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS
Tissue specificity：Exocrine pancreas-specific. Expressed in azaserine-induced pancreatic tumors (at protein level). Expressed in AR42J cells but not in ARIP, DSL6A, or DSL6B cells. Down-regulation is associated with the change of an azaserine-induced acinar cell carcinoma to a ductal phenotype. 1
Induction：
Developmental stage：Expressed from day 12 of gestation in pancreatic structures. 1
Protein families：