SET_RAT Q63945
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63945
Recommended name:Protein SET
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Set
Gene names (synonym ):Ab1-115
Gene names (ORF ):
Length:289
Mass:33,406
Sequence:MAPKRQSAILPQPKKPRPVAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEAEDDDDDDEEEEGLEDIDEEGDEDEGEEDDDEDEGEEGEEDEGEDD
Tissue specificity:Widely expressed, with higher expression in brain, thymus, spleen and bone marrow, and lower expression in heart, liver and muscle. 1
Induction:
Developmental stage:Higher expression in neonatal kidney than in adult. In the neonatal kidney, expressed more strongly in primitive nephrons undergoing early morphogenesis than in more developed structures. In 1-day old rat kidney, restricted to the first recognizable primitive nephron structures. Up-regulated after partial hepatectomy, with a peak after 24 hours.
Protein families:nucleosome assembly protein (NAP) family