BAX_RAT Q63690
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63690
Recommended name：Apoptosis regulator BAX
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Bax
Gene names (synonym )：
Gene names (ORF )：
Length：192
Mass：21,351
Sequence：MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Tissue specificity：Expressed in a wide variety of tissues, with highest levels in the testis and ovary.
Induction：
Developmental stage：
Protein families：Bcl-2 family