VAMP1_RAT Q63666
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63666
Recommended name：Vesicle-associated membrane protein 1
EC number：
Alternative names：Synaptobrevin-1
Cleaved into：
GeneID：
Gene names (primary )：Vamp1
Gene names (synonym )：Syb1
Gene names (ORF )：
Length：118
Mass：12,797
Sequence：MSAPAQPPAEGTEGAAPGGGPPGPPPNTTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYIFT
Tissue specificity：Expressed in brain and spleen (at protein level). Isoform 1 expressed at very high level in brain. Even higher level found in spinal cord. Isoform 3 expressed in kidney, spleen and liver. Isoforms 2 and 3 expressed in osteoblasts of trabecular bone. Also expressed in heart. 1
Induction：
Developmental stage：
Protein families：