SYCP3_RAT Q63520
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63520
Recommended name：Synaptonemal complex protein 3
EC number：
Alternative names：
Cleaved into：
GeneID：25561
Gene names (primary )：Sycp3
Gene names (synonym )：Scp3 1 Publication
Gene names (ORF )：
Length：257
Mass：29,733
Sequence：MLRGCGEVGAVDCSPEQLNKHLKMVPGGRKHSGKSGKPPLIDQPKKAFDFEKEDKDLSGSEEDAVDEKTQVFDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKKKRIEMYTKASFKASNQKIEQIWKTQQEEIQKLNNEYSQQFLSVLQQWELDMQKFEEQGEKLTNLFRQQQKIFQQTRIVQSQRMKAIKQLHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQEMANVRKSLQSMLF
Tissue specificity：Detected in spermatocytes and testis (at protein level) (PubMed:8289794, PubMed:9933407). Testis-specific (PubMed:8289794). 1
Induction：
Developmental stage：
Protein families：XLR/SYCP3 family