FXYD4_RAT Q63113
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63113
Recommended name:FXYD domain-containing ion transport regulator 4
EC number:
Alternative names:
Cleaved into:
GeneID:64190
Gene names (primary ):Fxyd4
Gene names (synonym ):
Gene names (ORF ):
Length:87
Mass:9,084
Sequence:MEGITCAFLLVLAGLPVLEANGPVDKGSPFYYDWESLQLGGMIFGGLLCIAGIAMALSGKCKCRRNHTPSSLPEKVTPLITPGSAST
Tissue specificity:Selectively present in the distal parts of the nephron (medullary and papillary collecting ducts and end portions of cortical collecting tubule) and in the epithelial cells of the distal colon. No expression is found in renal proximal tubule, loop of henle and distal tubule, proximal colon, small intestine, lung, choroid plexus, salivary glands, or brain. 1
Induction:
Developmental stage:By corticosteroids. 1
Protein families: