EST1E_RAT   Q63108


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63108

Recommended name:Carboxylesterase 1E

EC number:EC:3.1.1.1

Alternative names:Carboxyesterase ES-3 1 Publication ES-HTEL Egasyn Liver carboxylesterase 3 pI 5.5 esterase

Cleaved into:

GeneID:

Gene names  (primary ):Ces1e

Gene names  (synonym ):Ces1

Gene names  (ORF ):

Length:561

Mass:61,715

Sequence:MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDLLTNWEENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGASTYDGLALSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVALTAGLVKKNTRPLAEKIAVVSGCKSTTSASMVHCLRQKTEEELLETTLKLNLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGINKQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEKYLRHTDDPDRNKDQLLELIGDVIFGVPSVIVSRGHRDAGARTYMYEFQYRPSFSSKMKPSTVVGDHGDEIYSVFGAPILRGGTSKEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWSELLAMKPLHAGHTEL

Tissue specificity:Expressed in liver. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp