EST1E_RAT Q63108
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63108
Recommended name：Carboxylesterase 1E
EC number：EC:3.1.1.1
Alternative names：Carboxyesterase ES-3 1 Publication ES-HTEL Egasyn Liver carboxylesterase 3 pI 5.5 esterase
Cleaved into：
GeneID：
Gene names (primary )：Ces1e
Gene names (synonym )：Ces1
Gene names (ORF )：
Length：561
Mass：61,715
Sequence：MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDLLTNWEENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGASTYDGLALSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVALTAGLVKKNTRPLAEKIAVVSGCKSTTSASMVHCLRQKTEEELLETTLKLNLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGINKQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEKYLRHTDDPDRNKDQLLELIGDVIFGVPSVIVSRGHRDAGARTYMYEFQYRPSFSSKMKPSTVVGDHGDEIYSVFGAPILRGGTSKEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWSELLAMKPLHAGHTEL
Tissue specificity：Expressed in liver. 1
Induction：
Developmental stage：
Protein families：