FUT4_RAT Q62994
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62994
Recommended name：Alpha-(1,3)-fucosyltransferase 4
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Fut4
Gene names (synonym )：Rfuc-t
Gene names (ORF )：
Length：433
Mass：48,779
Sequence：MAPAGRKLQHESRCRPSRPVDAWRAAATTRGRCMGTPGARRTARRGGWGLPRTSSGLAAAGLLCTALTACLCWGQLPPLPWASPAPQRPVSVLLWWEPFGGRGGHSKPPPDCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKGPPDWPPPWGAQERTDEALELRVFDDQEGAVMLAREALETTGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWTLSYRTDSDIFVPYGFLYPRSHPAEQPSGLGPPLARKRGLVAWVVSHWNERQARVRYYHQLRRHVSVDVFGRAGPGQPVPAVGLLHTVARYKFYLAFENSQHVDYNTEKLWRNAFLAGAVPVLLGPDRANYEGFVPRGSFIHVDDFPSAASLAAYLLFLDRNVAVYRRYFHWRRSYAVHITSFWDEPWCQTCRAVQTSGDQPKSIHNLADWFQR
Tissue specificity：In adult, highest expression in spleen, testis, brain, lung, kidney and skeletal muscle and to a lesser extent in liver and heart.
Induction：
Developmental stage：
Protein families：