NOGG_RAT   Q62809


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62809

Recommended name:Noggin

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Nog

Gene names  (synonym ):

Gene names  (ORF ):

Length:144

Mass:16,139

Sequence:GGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWARYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Tissue specificity:Prominently expressed in the CNS. High levels found in mitral and tufted cells in the olfactory bulb, piriform cortex of the brain and Purkinje cells in the cerebellum. Low level expression seen in the lung, skeletal muscle and skin.

Induction:

Developmental stage:First detected at embryonic day 9 and in the brain, expression increases steadily from embryonic day 17 to postnatal day 19.

Protein families:


   💬 WhatsApp