CY24A_RAT   Q62737


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62737

Recommended name:Cytochrome b-245 light chain Curated

EC number:

Alternative names:

Cleaved into:

GeneID:79129

Gene names  (primary ):Cyba

Gene names  (synonym ):

Gene names  (ORF ):

Length:192

Mass:20,750

Sequence:MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRKKGSTMERCGQKYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGPQVNPIPVTDEVV

Tissue specificity:Expressed to a relatively high level in kidney, spleen, thymus and lung, and to a lower level in aorta, adrenals, and heart (PubMed:7578211). Expression is not detected in liver or brain (PubMed:7578211). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp