DHB2_RAT Q62730
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62730
Recommended name:Estradiol 17-beta-dehydrogenase 2
EC number:EC:1.1.1.62
Alternative names:17-beta-hydroxysteroid dehydrogenase type 2 (17-beta-HSD 2) Testosterone 17-beta-dehydrogenase (EC:1.1.1.239 1 Publication) . EC:1.1.1.239 (UniProtKB | ENZYME | Rhea) 1 Publication
Cleaved into:
GeneID:79243
Gene names (primary ):Hsd17b2
Gene names (synonym ):Edh17b2
Gene names (ORF ):
Length:381
Mass:41,967
Sequence:MNPFSSESAWLCLTATAVLGGMLLCKAWSSGQLRSQVVCLAGLWGGACLLSLSLLCSLFLLSVSCFFLLYVSSSDQDLLPVDQKAVLVTGADSGFGHALAKHLDKLGFTVFAGVLDKEGPGAEELRKNCSERLSVLQMDVTKPEQIKDVHSEVAEKIQDKGLWAVVNNAGVLHFPIDGELIPMTVYRKCMAVNFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAMIPFQMVAAYASTKAAISMFSAVIRQELAKWGVKVVTIHPGGFQTNIVGSQDSWDKMEKEILDHFSKEIQENYGQEYVHTQKLALPVMREMSNPDITPVLRDIQHAICAKNPSSFYCSGRMTYLWICFAAYSPISLLDYILKNYFTPKLMPRALRTAS
Tissue specificity:Highly expressed in the placenta, and in the small intestine, and liver. 1
Induction:
Developmental stage:
Protein families: