UXS1_RAT   Q5PQX0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5PQX0

Recommended name:UDP-glucuronic acid decarboxylase 1 1 Publication

EC number:EC:4.1.1.35

Alternative names:UDP-glucuronate decarboxylase 1 (UGD; UXS-1)

Cleaved into:

GeneID:246232

Gene names  (primary ):Uxs1

Gene names  (synonym ):

Gene names  (ORF ):

Length:420

Mass:47,539

Sequence:MVSKGLLRLVSSVNRRKMKLLLGIALFAYAASVWGNFVNMRSIQENGELKIESKIEEIIEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARVKKGRTRHS

Tissue specificity:Ubiquitous. Detected in heart, brain, spleen, lung, testis, liver, skeletal muscle and kidney. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp